Search › Peptide

[Oxidation]^3?GEQGPAGPPGFQGLPGPSGPAGEVGKPGER

Sequence: GEQGPAGPPGFQGLPGPSGPAGEVGKPGER (30 residues)
Modifications: 3× Oxidation (P) Unimod:35
Monoisotopic mass: 2831.34745 Da
Calculated ions: [M+H]+ 2832.3547 · [M+Na]+ 2854.3367 · [M+K]+ 2870.3106 · [M+2H]2+ 1416.6810

Observations (1)

Protein	Measured m/z	Calc. m/z	ppm	Species · tissue	Source	Status
Collagen alpha-2(I) chain UniProt P08123	2832.3300	2832.3547	-8.7	Homo sapiens (human) · Pancreas · Pancreatic tumour	10.1007/s00216-010-3554-6	Needs review Reported theoretical m/z differs from the calculated value; Peptide sequence not found in the UniProt protein sequence